GNAI1 anticorps
-
- Antigène Voir toutes GNAI1 Anticorps
- GNAI1 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 1 (GNAI1))
-
Reactivité
- Humain, Souris, Rat, Drosophila melanogaster
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GNAI1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
- Top Product
- Discover our top product GNAI1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GNAI1 Blocking Peptide, catalog no. 33R-10215, is also available for use as a blocking control in assays to test for specificity of this GNAI1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAI1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GNAI1 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 1 (GNAI1))
- Autre désignation
- GNAI1 (GNAI1 Produits)
- Sujet
- Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase, Go, a protein abundant in brain (GNAO1), and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- G-protein mediated Events
-