GTPBP10 anticorps
-
- Antigène Voir toutes GTPBP10 Anticorps
- GTPBP10 (GTP-Binding Protein 10 (GTPBP10))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GTPBP10 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFL
- Top Product
- Discover our top product GTPBP10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GTPBP10 Blocking Peptide, catalog no. 33R-4002, is also available for use as a blocking control in assays to test for specificity of this GTPBP10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GTPBP10 (GTP-Binding Protein 10 (GTPBP10))
- Autre désignation
- GTPBP10 (GTPBP10 Produits)
- Synonymes
- anticorps zgc:92334, anticorps ObgH2, anticorps 4930545J22Rik, anticorps BC034507, anticorps Cldn12, anticorps GTP-binding protein 10 (putative), anticorps GTP binding protein 10, anticorps gtpbp10, anticorps GTPBP10, anticorps Gtpbp10
- Sujet
- Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.
- Poids moléculaire
- 43 kDa (MW of target protein)
-