ACTR1B anticorps

N° du produit ABIN630653

Détail du produit anti-ACTR1B anticorps

Antigène: ACTR1B (ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (ACTR1B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTR1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ACTR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTR1B Blocking Peptide, catalog no. 33R-4434, is also available for use as a blocking control in assays to test for specificity of this ACTR1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTR1B

Antigène: ACTR1B (ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (ACTR1B))

Autre désignation: ACTR1B (ACTR1B Produits)

Sujet: ACTR1B is a 42.3 kDa subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis.

Poids moléculaire: 42 kDa (MW of target protein)