GMP Synthase anticorps (Middle Region)

N° du produit ABIN630661

Détail du produit anti-GMP Synthase anticorps

Antigène: GMP Synthase (GMPS) (Guanine Monophosphate Synthetase (GMPS))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GMP Synthase est non-conjugé

Application: Western Blotting (WB)

Specificité: GMPS antibody was raised against the middle region of GMPS

Purification: Affinity purified

Immunogène: GMPS antibody was raised using the middle region of GMPS corresponding to a region with amino acids VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GMPS Blocking Peptide, catalog no. 33R-9455, is also available for use as a blocking control in assays to test for specificity of this GMPS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GMP Synthase

Antigène: GMP Synthase (GMPS) (Guanine Monophosphate Synthetase (GMPS))

Autre désignation: GMPS (GMPS Produits)

Synonymes: anticorps GMPS, anticorps AA591640, anticorps AI047208, anticorps sb:cb632, anticorps wu:fb76b01, anticorps wu:fi05a09, anticorps zgc:66002, anticorps guanine monophosphate synthase, anticorps guanine monophosphate synthase L homeolog, anticorps guanine monophosphate synthetase, anticorps GMPS, anticorps gmps.L, anticorps gmps, anticorps Gmps

Sujet: In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP.

Poids moléculaire: 77 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process