HIST2H2BF anticorps (N-Term)

N° du produit ABIN630669

Détail du produit anti-HIST2H2BF anticorps

Antigène: HIST2H2BF (Histone H2B Type 2-F (HIST2H2BF))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HIST2H2BF est non-conjugé

Application: Western Blotting (WB)

Specificité: HIST2 H2 F antibody was raised against the N terminal of HIST2 2 F

Purification: Affinity purified

Immunogène: HIST2 H2 F antibody was raised using the N terminal of HIST2 2 F corresponding to a region with amino acids MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HIST2H2BF Blocking Peptide, catalog no. 33R-6272, is also available for use as a blocking control in assays to test for specificity of this HIST2H2BF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIST0 0 F antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HIST2H2BF

Antigène: HIST2H2BF (Histone H2B Type 2-F (HIST2H2BF))

Autre désignation: HIST2H2BF (HIST2H2BF Produits)

Synonymes: anticorps histone cluster 2, H2bf, anticorps histone cluster 2 H2B family member f, anticorps HIST2H2BF

Sujet: HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Poids moléculaire: 14 kDa (MW of target protein)