GGPS1 anticorps (C-Term)
-
- Antigène Voir toutes GGPS1 Anticorps
- GGPS1 (Geranylgeranyl Diphosphate Synthase 1 (GGPS1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GGPS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GGPS1 antibody was raised against the C terminal of GGPS1
- Purification
- Affinity purified
- Immunogène
- GGPS1 antibody was raised using the C terminal of GGPS1 corresponding to a region with amino acids LEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
- Top Product
- Discover our top product GGPS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GGPS1 Blocking Peptide, catalog no. 33R-4885, is also available for use as a blocking control in assays to test for specificity of this GGPS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGPS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GGPS1 (Geranylgeranyl Diphosphate Synthase 1 (GGPS1))
- Autre désignation
- GGPS1 (GGPS1 Produits)
- Synonymes
- anticorps geranylgeranyl pyrophosphate synthase 1, anticorps DDBDRAFT_0192027, anticorps DDBDRAFT_0233098, anticorps DDB_0192027, anticorps DDB_0233098, anticorps GGPPS, anticorps GGPPS1, anticorps 1810026C22Rik, anticorps 9530089B04Rik, anticorps AI843169, anticorps C79210, anticorps Crlf3, anticorps rGGPS1a, anticorps rGGPS1a1, anticorps rGGPS1a2, anticorps rGGPS1a3, anticorps fb05f09, anticorps qm, anticorps wu:fb05f09, anticorps zgc:101591, anticorps zgc:56514, anticorps geranylgeranyl pyrophosphate synthase 1, anticorps geranylgeranyl pyrophosphate synthetase, anticorps geranyl pyrophosphate synthase, anticorps geranylgeranyl pyrophosphate synthase,chloroplastic, anticorps geranylgeranyl diphosphate synthase 1, anticorps geranylgeranyl diphosphate synthase 1 L homeolog, anticorps GGPS1, anticorps gGPS1, anticorps ggps1, anticorps Ggps1, anticorps ggps1.L
- Sujet
- GGPS1 is a member of the prenyltransferase family with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor.
- Poids moléculaire
- 35 kDa (MW of target protein)
-