PINX1 anticorps (N-Term)

N° du produit ABIN630717

Détail du produit anti-PINX1 anticorps

Antigène: PINX1 (PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PINX1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PINX1 antibody was raised against the N terminal of PINX1

Purification: Affinity purified

Immunogène: PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PINX1 Blocking Peptide, catalog no. 33R-2516, is also available for use as a blocking control in assays to test for specificity of this PINX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PINX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PINX1

Antigène: PINX1 (PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1))

Autre désignation: PINX1 (PINX1 Produits)

Synonymes: anticorps PINX1, anticorps LPTL, anticorps LPTS, anticorps 2210403I16Rik, anticorps 2610028A01Rik, anticorps 67-11-3, anticorps AU024023, anticorps LPTS1, anticorps RGD1566025, anticorps PIN2/TERF1 interacting telomerase inhibitor 1, anticorps PIN2/TERF1 interacting, telomerase inhibitor 1, anticorps PINX1, anticorps Pinx1

Sujet: PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres.

Poids moléculaire: 37 kDa (MW of target protein)