Myozenin 1 anticorps (Middle Region)

N° du produit ABIN630770

Détail du produit anti-Myozenin 1 anticorps

Antigène: Myozenin 1 (MYOZ1)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Myozenin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Myozenin 1 antibody was raised against the middle region of MYOZ1

Purification: Affinity purified

Immunogène: Myozenin 1 antibody was raised using the middle region of MYOZ1 corresponding to a region with amino acids TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Myozenin 1 Blocking Peptide, catalog no. 33R-9352, is also available for use as a blocking control in assays to test for specificity of this Myozenin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYOZ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Myozenin 1

Antigène: Myozenin 1 (MYOZ1)

Autre désignation: Myozenin 1 (MYOZ1 Produits)

Synonymes: anticorps LOC100009016, anticorps myoz1, anticorps MGC64407, anticorps zgc:92347, anticorps MGC89225, anticorps zgc:77785, anticorps MYOZ1, anticorps CS-2, anticorps FATZ, anticorps MYOZ, anticorps 2310001N11Rik, anticorps AV090278, anticorps Myoz, anticorps RGD1561064, anticorps myozenin 1, anticorps myozenin 1 L homeolog, anticorps myozenin 1b, anticorps myozenin 1a, anticorps MYOZ1, anticorps myoz1.L, anticorps myoz1b, anticorps myoz1, anticorps myoz1a, anticorps Myoz1

Sujet: Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere.

Poids moléculaire: 32 kDa (MW of target protein)