Myozenin 1 anticorps (Middle Region)
-
- Antigène Voir toutes Myozenin 1 (MYOZ1) Anticorps
- Myozenin 1 (MYOZ1)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Myozenin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Myozenin 1 antibody was raised against the middle region of MYOZ1
- Purification
- Affinity purified
- Immunogène
- Myozenin 1 antibody was raised using the middle region of MYOZ1 corresponding to a region with amino acids TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY
- Top Product
- Discover our top product MYOZ1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Myozenin 1 Blocking Peptide, catalog no. 33R-9352, is also available for use as a blocking control in assays to test for specificity of this Myozenin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYOZ1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Myozenin 1 (MYOZ1)
- Autre désignation
- Myozenin 1 (MYOZ1 Produits)
- Synonymes
- anticorps LOC100009016, anticorps myoz1, anticorps MGC64407, anticorps zgc:92347, anticorps MGC89225, anticorps zgc:77785, anticorps MYOZ1, anticorps CS-2, anticorps FATZ, anticorps MYOZ, anticorps 2310001N11Rik, anticorps AV090278, anticorps Myoz, anticorps RGD1561064, anticorps myozenin 1, anticorps myozenin 1 L homeolog, anticorps myozenin 1b, anticorps myozenin 1a, anticorps MYOZ1, anticorps myoz1.L, anticorps myoz1b, anticorps myoz1, anticorps myoz1a, anticorps Myoz1
- Sujet
- Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere.
- Poids moléculaire
- 32 kDa (MW of target protein)
-