CSTB anticorps
-
- Antigène Voir toutes CSTB Anticorps
- CSTB (Cystatin B (Stefin B) (CSTB))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CSTB est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAG
- Top Product
- Discover our top product CSTB Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cystatin B Blocking Peptide, catalog no. 33R-6226, is also available for use as a blocking control in assays to test for specificity of this Cystatin B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CSTB (Cystatin B (Stefin B) (CSTB))
- Autre désignation
- Cystatin B (CSTB Produits)
- Synonymes
- anticorps CST6, anticorps EPM1, anticorps EPM1A, anticorps PME, anticorps STFB, anticorps ULD, anticorps CSTB, anticorps Cyb, anticorps Epm1, anticorps Stfb, anticorps MGC189005, anticorps pme, anticorps cst6, anticorps epm1, anticorps stfb, anticorps AA960480, anticorps ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, anticorps ATCYS6, anticorps ATCYSB, anticorps cystatin B, anticorps LOC100008600, anticorps LOC100136235, anticorps CPI1, anticorps cystatin B, anticorps cystatin B (stefin B), anticorps cystatin 14a, tandem duplicate 2, anticorps cystatin-B, anticorps CSTB, anticorps Cstb, anticorps cstb, anticorps cst14a.2, anticorps CYSB, anticorps cpi1, anticorps LOC101123265
- Sujet
- CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor.
- Poids moléculaire
- 11 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation
-