FLII anticorps

N° du produit ABIN630840

Détail du produit anti-FLII anticorps

Antigène: FLII (Flightless I Homolog (FLII))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FLII est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FLII antibody was raised using a synthetic peptide corresponding to a region with amino acids LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLII Blocking Peptide, catalog no. 33R-4761, is also available for use as a blocking control in assays to test for specificity of this FLII antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLII antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FLII

Antigène: FLII (Flightless I Homolog (FLII))

Autre désignation: FLII (FLII Produits)

Synonymes: anticorps FLI, anticorps FLIL, anticorps Fli1, anticorps 3632430F08Rik, anticorps Fliih, anticorps im:7141769, anticorps DKFZp459O043, anticorps flightless, anticorps FLII, actin remodeling protein, anticorps flightless I actin binding protein, anticorps protein flightless-1 homolog, anticorps FLII, actin remodeling protein S homeolog, anticorps Protein flightless-1 homolog, anticorps FLII, anticorps Flii, anticorps flii, anticorps LOC585336, anticorps LOC100640615, anticorps flii.S, anticorps fli-1

Sujet: FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Poids moléculaire: 145 kDa (MW of target protein)