PPIL2 anticorps

N° du produit ABIN630873

Détail du produit anti-PPIL2 anticorps

Antigène: PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPIL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPIL2 Blocking Peptide, catalog no. 33R-3545, is also available for use as a blocking control in assays to test for specificity of this PPIL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPIL2

Antigène: PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))

Autre désignation: PPIL2 (PPIL2 Produits)

Synonymes: anticorps cyc4, anticorps cyp60, anticorps hcyp-60, anticorps CYC4, anticorps CYP60, anticorps Cyp-60, anticorps UBOX7, anticorps hCyP-60, anticorps 0610009L05Rik, anticorps 1700016N17Rik, anticorps 4921520K19Rik, anticorps 4930511F14Rik, anticorps AA589416, anticorps C130078A06Rik, anticorps si:dkeyp-86g2.1, anticorps zgc:56616, anticorps zgc:86735, anticorps peptidylprolyl isomerase like 2 S homeolog, anticorps peptidylprolyl isomerase like 2, anticorps peptidylprolyl isomerase (cyclophilin)-like 2, anticorps ppil2.S, anticorps PPIL2, anticorps ppil2, anticorps Ppil2

Sujet: PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.

Poids moléculaire: 59 kDa (MW of target protein)