ACADS anticorps (Middle Region)

N° du produit ABIN630890

Détail du produit anti-ACADS anticorps

Antigène: ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACADS est non-conjugé

Application: Western Blotting (WB)

Specificité: ACADS antibody was raised against the middle region of ACADS

Purification: Affinity purified

Immunogène: ACADS antibody was raised using the middle region of ACADS corresponding to a region with amino acids FTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACADS Blocking Peptide, catalog no. 33R-3100, is also available for use as a blocking control in assays to test for specificity of this ACADS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACADS

Antigène: ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))

Autre désignation: ACADS (Acads Produits)

Synonymes: anticorps ACAD3, anticorps SCAD, anticorps wu:fc44c01, anticorps zgc:92400, anticorps acad3, anticorps scad, anticorps Scad, anticorps AI196007, anticorps Bcd-1, anticorps Bcd1, anticorps Hdlq8, anticorps acyl-CoA dehydrogenase short chain, anticorps acyl-CoA dehydrogenase, C-2 to C-3 short chain, anticorps acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain, anticorps acyl-CoA dehydrogenase, C-2 to C-3 short chain L homeolog, anticorps acyl-Coenzyme A dehydrogenase, short chain, anticorps ACADS, anticorps acads, anticorps Acads, anticorps acads.L

Sujet: ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency. This gene encodes a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process