ARG2 anticorps (Arg2, C-Term)

N° du produit ABIN630895

Détail du produit anti-ARG2 anticorps

Antigène: ARG2 (Arginase, Type II (ARG2))

Épitope: Arg2, C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARG2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Arginase 2 antibody was raised against the C terminal of ARG2

Purification: Affinity purified

Immunogène: Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Arginase 2 Blocking Peptide, catalog no. 33R-8306, is also available for use as a blocking control in assays to test for specificity of this Arginase 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARG2

Antigène: ARG2 (Arginase, Type II (ARG2))

Autre désignation: Arginase 2 (ARG2 Produits)

Synonymes: anticorps AII, anticorps AU022422, anticorps zgc:65793, anticorps zgc:85630, anticorps wu:fb67g02, anticorps ARG2, anticorps LeARG2, anticorps arg1, anticorps arg3, anticorps arg2, anticorps arg2-c, anticorps arg2-b, anticorps arginase 2, anticorps arginase type II, anticorps arginase 2 L homeolog, anticorps arginase 2 S homeolog, anticorps ARG2, anticorps Arg2, anticorps arg2, anticorps arg2.L, anticorps arg2.S

Sujet: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. ARG2 (type II isoform) is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood, it is thought to play a role in nitric oxide and polyamine metabolism.

Poids moléculaire: 36 kDa (MW of target protein)