CLECL1 anticorps (Middle Region)

N° du produit ABIN630902

Détail du produit anti-CLECL1 anticorps

Antigène: CLECL1 (C-Type Lectin-Like 1 (CLECL1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLECL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CLECL1 antibody was raised against the middle region of CLECL1

Purification: Affinity purified

Immunogène: CLECL1 antibody was raised using the middle region of CLECL1 corresponding to a region with amino acids FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLECL1 Blocking Peptide, catalog no. 33R-3069, is also available for use as a blocking control in assays to test for specificity of this CLECL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLECL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLECL1

Antigène: CLECL1 (C-Type Lectin-Like 1 (CLECL1))

Autre désignation: CLECL1 (CLECL1 Produits)

Synonymes: anticorps DCAL-1, anticorps DCAL1, anticorps C-type lectin like 1, anticorps CLECL1

Sujet: DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 production. DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells.

Poids moléculaire: 19 kDa (MW of target protein)