CLECL1 anticorps (Middle Region)
-
- Antigène Voir toutes CLECL1 Anticorps
- CLECL1 (C-Type Lectin-Like 1 (CLECL1))
-
Épitope
- Middle Region
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CLECL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CLECL1 antibody was raised against the middle region of CLECL1
- Purification
- Affinity purified
- Immunogène
- CLECL1 antibody was raised using the middle region of CLECL1 corresponding to a region with amino acids FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK
- Top Product
- Discover our top product CLECL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CLECL1 Blocking Peptide, catalog no. 33R-3069, is also available for use as a blocking control in assays to test for specificity of this CLECL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLECL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CLECL1 (C-Type Lectin-Like 1 (CLECL1))
- Autre désignation
- CLECL1 (CLECL1 Produits)
- Synonymes
- anticorps DCAL-1, anticorps DCAL1, anticorps C-type lectin like 1, anticorps CLECL1
- Sujet
- DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 production. DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells.
- Poids moléculaire
- 19 kDa (MW of target protein)
-