PSMB4 anticorps

N° du produit ABIN630916

Détail du produit anti-PSMB4 anticorps

Antigène: PSMB4 (Proteasome (Prosome, Macropain) Subunit, beta Type, 4 (PSMB4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMB4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMB4 Blocking Peptide, catalog no. 33R-8775, is also available for use as a blocking control in assays to test for specificity of this PSMB4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMB4

Antigène: PSMB4 (Proteasome (Prosome, Macropain) Subunit, beta Type, 4 (PSMB4))

Autre désignation: PSMB4 (PSMB4 Produits)

Synonymes: anticorps An18g06680, anticorps PSMB4, anticorps Pros-27, anticorps HN3, anticorps HsN3, anticorps PROS-26, anticorps PROS26, anticorps im:6909492, anticorps zgc:110330, anticorps proteasome subunit beta type-4, anticorps proteasome subunit beta 4, anticorps proteasome (prosome, macropain) subunit, beta type 4, anticorps proteasome subunit beta 4 L homeolog, anticorps ANI_1_890164, anticorps PSMB4, anticorps psmb4, anticorps Psmb4, anticorps psmb4.L

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB4 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA