PSMB5 anticorps

N° du produit ABIN630923

Détail du produit anti-PSMB5 anticorps

Antigène: PSMB5 (Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMB5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMB5 Blocking Peptide, catalog no. 33R-4193, is also available for use as a blocking control in assays to test for specificity of this PSMB5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMB5

Antigène: PSMB5 (Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5))

Autre désignation: PSMB5 (PSMB5 Produits)

Synonymes: anticorps LMPX, anticorps MB1, anticorps X, anticorps etID309919.2, anticorps fb59c07, anticorps si:zc14a17.13, anticorps wu:fb59c07, anticorps x, anticorps zgc:86820, anticorps proteasome subunit beta 5, anticorps proteasome (prosome, macropain) subunit, beta type 5, anticorps proteasome subunit beta 5 L homeolog, anticorps proteasome (prosome, macropain) subunit, beta type, 5, anticorps PSMB5, anticorps psmb5, anticorps Psmb5, anticorps psmb5.L

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB5 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA