CSTB anticorps

N° du produit ABIN630947

Détail du produit anti-CSTB anticorps

Antigène: CSTB (Cystatin B (Stefin B) (CSTB))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSTB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cystatin B Blocking Peptide, catalog no. 33R-1232, is also available for use as a blocking control in assays to test for specificity of this Cystatin B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSTB

Antigène: CSTB (Cystatin B (Stefin B) (CSTB))

Autre désignation: Cystatin B (CSTB Produits)

Synonymes: anticorps CST6, anticorps EPM1, anticorps EPM1A, anticorps PME, anticorps STFB, anticorps ULD, anticorps CSTB, anticorps Cyb, anticorps Epm1, anticorps Stfb, anticorps MGC189005, anticorps pme, anticorps cst6, anticorps epm1, anticorps stfb, anticorps AA960480, anticorps ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, anticorps ATCYS6, anticorps ATCYSB, anticorps cystatin B, anticorps LOC100008600, anticorps LOC100136235, anticorps CPI1, anticorps cystatin B, anticorps cystatin B (stefin B), anticorps cystatin 14a, tandem duplicate 2, anticorps cystatin-B, anticorps CSTB, anticorps Cstb, anticorps cstb, anticorps cst14a.2, anticorps CYSB, anticorps cpi1, anticorps LOC101123265

Sujet: CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b.

Poids moléculaire: 11 kDa (MW of target protein)

Pathways: Response to Water Deprivation