PSMA2 anticorps

N° du produit ABIN630966

Détail du produit anti-PSMA2 anticorps

Antigène: PSMA2 (Proteasome Subunit alpha 2 (PSMA2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PSMA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMA2 Blocking Peptide, catalog no. 33R-9560, is also available for use as a blocking control in assays to test for specificity of this PSMA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMA2

Antigène: PSMA2 (Proteasome Subunit alpha 2 (PSMA2))

Autre désignation: PSMA2 (PSMA2 Produits)

Synonymes: anticorps Lmpc3, anticorps wu:faa49c06, anticorps wu:fb98h03, anticorps zgc:110710, anticorps HC3, anticorps MU, anticorps PMSA2, anticorps PSC2, anticorps proteasome (prosome, macropain) subunit, alpha type 2, anticorps proteasome subunit alpha 2, anticorps proteasome subunit alpha 2 L homeolog, anticorps Psma2, anticorps psma2, anticorps psma2.L, anticorps PSMA2

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA2 is a member of the peptidase T1A family, that is a 20S core alpha subunit.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA