NIT2 anticorps (Middle Region)

N° du produit ABIN630973

Détail du produit anti-NIT2 anticorps

Antigène: NIT2 (Nitrilase Family, Member 2 (NIT2))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NIT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NIT2 antibody was raised against the middle region of NIT2

Purification: Affinity purified

Immunogène: NIT2 antibody was raised using the middle region of NIT2 corresponding to a region with amino acids VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NIT2 Blocking Peptide, catalog no. 33R-9421, is also available for use as a blocking control in assays to test for specificity of this NIT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NIT2

Antigène: NIT2 (Nitrilase Family, Member 2 (NIT2))

Autre désignation: NIT2 (NIT2 Produits)

Synonymes: anticorps nit2a, anticorps 1190017B19Rik, anticorps D16Ertd502e, anticorps RGD1310494, anticorps zgc:109720, anticorps nitrilase family member 2 S homeolog, anticorps nitrilase family member 2, anticorps nitrilase family, member 2, anticorps nit2.S, anticorps NIT2, anticorps nit2, anticorps Nit2

Sujet: NIT2 belongs to the UPF0012 family and contains 1 CN hydrolase domain. Overexpression of NIT2 decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.

Poids moléculaire: 30 kDa (MW of target protein)