HISPPD1 anticorps (Middle Region)

N° du produit ABIN630976

Détail du produit anti-HISPPD1 anticorps

Antigène: HISPPD1 (PPIP5K2) (diphosphoinositol Pentakisphosphate Kinase 2 (PPIP5K2))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HISPPD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HISPPD1 antibody was raised against the middle region of HISPPD1

Purification: Affinity purified

Immunogène: HISPPD1 antibody was raised using the middle region of HISPPD1 corresponding to a region with amino acids SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HISPPD1 Blocking Peptide, catalog no. 33R-8626, is also available for use as a blocking control in assays to test for specificity of this HISPPD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HISPPD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HISPPD1

Antigène: HISPPD1 (PPIP5K2) (diphosphoinositol Pentakisphosphate Kinase 2 (PPIP5K2))

Autre désignation: HISPPD1 (PPIP5K2 Produits)

Synonymes: anticorps HISPPD1, anticorps IP7K2, anticorps VIP2, anticorps AW555814, anticorps D330021B20, anticorps Hisppd1, anticorps Vip2, anticorps mKIAA0433, anticorps hisppd1, anticorps ip7k2, anticorps vip2, anticorps diphosphoinositol pentakisphosphate kinase 2, anticorps diphosphoinositol pentakisphosphate kinase 2 L homeolog, anticorps PPIP5K2, anticorps Ppip5k2, anticorps ppip5k2.L

Sujet: Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC 2.7.4.21) and PP-IP5 (also called IP7) kinase (EC 2.7.4.24) activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively.

Poids moléculaire: 138 kDa (MW of target protein)

Pathways: Inositol Metabolic Process