CDT2/RAMP anticorps

N° du produit ABIN630978

Détail du produit anti-CDT2/RAMP anticorps

Antigène: CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDT2/RAMP est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DTL antibody was raised using a synthetic peptide corresponding to a region with amino acids VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DTL Blocking Peptide, catalog no. 33R-9712, is also available for use as a blocking control in assays to test for specificity of this DTL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDT2/RAMP

Antigène: CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))

Autre désignation: DTL (DTL Produits)

Synonymes: anticorps CDT2, anticorps DCAF2, anticorps L2DTL, anticorps RAMP, anticorps 2810047L02Rik, anticorps 5730564G15Rik, anticorps Ramp, anticorps RGD1310439, anticorps cdt2, anticorps cdt2-a, anticorps dcaf2, anticorps l2dtl, anticorps ramp, anticorps cb151, anticorps chunp6871, anticorps wu:fb54b02, anticorps denticleless E3 ubiquitin protein ligase homolog, anticorps denticleless E3 ubiquitin protein ligase, anticorps denticleless E3 ubiquitin protein ligase homolog S homeolog, anticorps denticleless E3 ubiquitin protein ligase homolog (Drosophila), anticorps DTL, anticorps Dtl, anticorps dtl.S, anticorps dtl

Sujet: DTL is required for CDT1 proteolysis in response to DNA damage through the CUL4-DDB1 E3 ubiquitin-protein ligase. It seems to be necessary to ensure proper cell cycle regulation of DNA replication. DTL may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. It also may play a role in cell proliferation of NT2 embryonal carcinoma cells.

Poids moléculaire: 79 kDa (MW of target protein)