MRPS2 anticorps (N-Term)
-
- Antigène Voir toutes MRPS2 Anticorps
- MRPS2 (Mitochondrial Ribosomal Protein S2 (MRPS2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MRPS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MRPS2 antibody was raised against the N terminal of MRPS2
- Purification
- Affinity purified
- Immunogène
- MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR
- Top Product
- Discover our top product MRPS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MRPS2 Blocking Peptide, catalog no. 33R-5791, is also available for use as a blocking control in assays to test for specificity of this MRPS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MRPS2 (Mitochondrial Ribosomal Protein S2 (MRPS2))
- Autre désignation
- MRPS2 (MRPS2 Produits)
- Synonymes
- anticorps MRP-S2, anticorps S2mt, anticorps 1500019M10Rik, anticorps mitochondrial ribosomal protein S2, anticorps Mrps2, anticorps MRPS2
- Sujet
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.
- Poids moléculaire
- 33 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-