MRPS2 anticorps (N-Term)

N° du produit ABIN630996

Détail du produit anti-MRPS2 anticorps

Antigène: MRPS2 (Mitochondrial Ribosomal Protein S2 (MRPS2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPS2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPS2 antibody was raised against the N terminal of MRPS2

Purification: Affinity purified

Immunogène: MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPS2 Blocking Peptide, catalog no. 33R-5791, is also available for use as a blocking control in assays to test for specificity of this MRPS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPS2

Antigène: MRPS2 (Mitochondrial Ribosomal Protein S2 (MRPS2))

Autre désignation: MRPS2 (MRPS2 Produits)

Synonymes: anticorps MRP-S2, anticorps S2mt, anticorps 1500019M10Rik, anticorps mitochondrial ribosomal protein S2, anticorps Mrps2, anticorps MRPS2

Sujet: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome