MRPL48 anticorps (Middle Region)

N° du produit ABIN631007

Détail du produit anti-MRPL48 anticorps

Antigène: MRPL48 (Mitochondrial Ribosomal Protein L48 (MRPL48))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPL48 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPL48 antibody was raised against the middle region of MRPL48

Purification: Affinity purified

Immunogène: MRPL48 antibody was raised using the middle region of MRPL48 corresponding to a region with amino acids KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPL48 Blocking Peptide, catalog no. 33R-4469, is also available for use as a blocking control in assays to test for specificity of this MRPL48 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPL48

Antigène: MRPL48 (Mitochondrial Ribosomal Protein L48 (MRPL48))

Autre désignation: MRPL48 (MRPL48 Produits)

Synonymes: anticorps HSPC290, anticorps L48MT, anticorps MRP-L48, anticorps 1810030E20Rik, anticorps 2610028L11Rik, anticorps CGI-118, anticorps D4Ertd786e, anticorps mitochondrial ribosomal protein L48, anticorps MRPL48, anticorps Mrpl48

Sujet: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Poids moléculaire: 24 kDa (MW of target protein)