ATP5F1 anticorps (Middle Region)
-
- Antigène Voir toutes ATP5F1 Anticorps
- ATP5F1 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit B1 (ATP5F1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP5F1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP5 F1 antibody was raised against the middle region of ATP5 1
- Purification
- Affinity purified
- Immunogène
- ATP5 F1 antibody was raised using the middle region of ATP5 1 corresponding to a region with amino acids VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST
- Top Product
- Discover our top product ATP5F1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP5F1 Blocking Peptide, catalog no. 33R-9863, is also available for use as a blocking control in assays to test for specificity of this ATP5F1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP5F1 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit B1 (ATP5F1))
- Autre désignation
- ATP5F1 (ATP5F1 Produits)
- Synonymes
- anticorps PIG47, anticorps C76477, anticorps wu:fb59g11, anticorps wu:fj08b08, anticorps zgc:101887, anticorps ATP synthase, H+ transporting, mitochondrial Fo complex subunit B1, anticorps ATP synthase, H+ transporting, mitochondrial Fo complex subunit B1 S homeolog, anticorps ATP synthase F(0) complex subunit B1, mitochondrial, anticorps ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1, anticorps ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1, anticorps ATP5F1, anticorps atp5f1.S, anticorps atp5f1, anticorps LOC479901, anticorps Atp5f1
- Sujet
- ATP5F1 is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8).
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Proton Transport, Ribonucleoside Biosynthetic Process
-