NKD2 anticorps

N° du produit ABIN631060

Détail du produit anti-NKD2 anticorps

Antigène: NKD2 (Naked Cuticle Homolog 2 (NKD2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NKD2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NKD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARDKQELPNGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGER

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NKD2 Blocking Peptide, catalog no. 33R-1463, is also available for use as a blocking control in assays to test for specificity of this NKD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NKD2

Antigène: NKD2 (Naked Cuticle Homolog 2 (NKD2))

Autre désignation: NKD2 (NKD2 Produits)

Synonymes: anticorps nkd2, anticorps nkd2l, anticorps 2210403L10Rik, anticorps AW212591, anticorps Naked2, anticorps naked cuticle homolog 2b, anticorps naked cuticle 2 homolog (Drosophila), anticorps naked cuticle homolog 2, anticorps naked cuticle homolog 2a, anticorps nkd2b, anticorps Nkd2, anticorps NKD2, anticorps nkd2a

Sujet: In the mouse, NkDa is a Dishevelled-binding protein that functions as a negative regulator of the Wnt-beta-catenin-Tcf signaling pathway.

Poids moléculaire: 34 kDa (MW of target protein)