ECHS1 anticorps (N-Term)

N° du produit ABIN631063

Détail du produit anti-ECHS1 anticorps

Antigène: ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ECHS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ECHS1 antibody was raised against the N terminal of ECHS1

Purification: Affinity purified

Immunogène: ECHS1 antibody was raised using the N terminal of ECHS1 corresponding to a region with amino acids IIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ECHS1 Blocking Peptide, catalog no. 33R-3990, is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ECHS1

Antigène: ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))

Autre désignation: ECHS1 (ECHS1 Produits)

Synonymes: anticorps SCEH, anticorps cOR6not, anticorps fj55e05, anticorps si:zc217g15.1, anticorps wu:fj55e05, anticorps C80529, anticorps enoyl-CoA hydratase, short chain, 1, mitochondrial L homeolog, anticorps enoyl-CoA hydratase, short chain 1, anticorps enoyl CoA hydratase, short chain, 1, mitochondrial, anticorps enoyl Coenzyme A hydratase, short chain, 1, mitochondrial, anticorps echs1.L, anticorps ECHS1, anticorps Echs1, anticorps echs1

Sujet: ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The protein is a member of the hydratase/isomerase superfamily.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process