DYNLL1 anticorps (N-Term)

N° du produit ABIN631146

Détail du produit anti-DYNLL1 anticorps

Antigène: DYNLL1 (Dynein, Light Chain, LC8-Type 1 (DYNLL1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DYNLL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DYNLL1 antibody was raised against the N terminal of DYNLL1

Purification: Affinity purified

Immunogène: DYNLL1 antibody was raised using the N terminal of DYNLL1 corresponding to a region with amino acids MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DYNLL1 Blocking Peptide, catalog no. 33R-5809, is also available for use as a blocking control in assays to test for specificity of this DYNLL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DYNLL1

Antigène: DYNLL1 (Dynein, Light Chain, LC8-Type 1 (DYNLL1))

Autre désignation: DYNLL1 (DYNLL1 Produits)

Synonymes: anticorps DLC1, anticorps DLC8, anticorps DNCL1, anticorps DNCLC1, anticorps LC8, anticorps LC8a, anticorps PIN, anticorps hdlc1, anticorps dynll2, anticorps wu:fd56c09, anticorps zgc:73406, anticorps Dlc8, anticorps Dnclc1, anticorps Pin, anticorps 8kDLC, anticorps lc8, anticorps dlc1, anticorps dlc8, anticorps lc8a, anticorps dncl1, anticorps dnclc1, anticorps dynll1a, anticorps MGC68763, anticorps CDLC2, anticorps dynll1, anticorps dynll1b, anticorps pin, anticorps MGC89636, anticorps dynein light chain LC8-type 1, anticorps dynein, light chain, LC8-type 1, anticorps dynein light chain LC8-type 1 S homeolog, anticorps dynein light chain LC8-type 1 L homeolog, anticorps Dynein light chain 1, cytoplasmic, anticorps DYNLL1, anticorps dynll1, anticorps Dynll1, anticorps dynll1.S, anticorps dynll1.L, anticorps dlc-1

Sujet: Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kDa. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. DYNLL1 is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity.

Poids moléculaire: 10 kDa (MW of target protein)

Pathways: M Phase, Tube Formation, Positive Regulation of Endopeptidase Activity