DNAJB6 anticorps

N° du produit ABIN631148

Détail du produit anti-DNAJB6 anticorps

Antigène: DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6 (DNAJB6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAJB6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DNAJB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNAJB6 Blocking Peptide, catalog no. 33R-7052, is also available for use as a blocking control in assays to test for specificity of this DNAJB6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAJB6

Antigène: DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6 (DNAJB6))

Autre désignation: DNAJB6 (DNAJB6 Produits)

Synonymes: anticorps DJ4, anticorps DnaJ, anticorps HHDJ1, anticorps HSJ-2, anticorps HSJ2, anticorps LGMD1E, anticorps MRJ, anticorps MSJ-1, anticorps Mrj, anticorps mDj4, anticorps dnajb6, anticorps zgc:56709, anticorps hsj2, anticorps DnaJ heat shock protein family (Hsp40) member B6, anticorps DnaJ (Hsp40) homolog, subfamily B, member 6b, anticorps DnaJ heat shock protein family (Hsp40) member B6 S homeolog, anticorps DnaJ heat shock protein family (Hsp40) member B6 L homeolog, anticorps DNAJB6, anticorps Dnajb6, anticorps dnajb6b, anticorps dnajb6.S, anticorps dnajb6.L

Sujet: DNAJB6 is a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons.

Poids moléculaire: 36 kDa (MW of target protein)