PADI2 anticorps (Middle Region)

N° du produit ABIN631162

Détail du produit anti-PADI2 anticorps

Antigène: PADI2 (Peptidyl Arginine Deiminase, Type II (PADI2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PADI2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PADI2 antibody was raised against the middle region of PADI2

Purification: Affinity purified

Immunogène: PADI2 antibody was raised using the middle region of PADI2 corresponding to a region with amino acids RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PADI2 Blocking Peptide, catalog no. 33R-7920, is also available for use as a blocking control in assays to test for specificity of this PADI2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PADI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PADI2

Antigène: PADI2 (Peptidyl Arginine Deiminase, Type II (PADI2))

Autre désignation: PADI2 (PADI2 Produits)

Synonymes: anticorps PADI2, anticorps PAD-H19, anticorps PAD2, anticorps PDI2, anticorps Pdi, anticorps Pdi2, anticorps mKIAA0994, anticorps peptidyl arginine deiminase 2, anticorps peptidyl arginine deiminase, type II, anticorps protein-arginine deiminase type-2, anticorps peptidyl arginine deiminase, type II S homeolog, anticorps PADI2, anticorps padi2, anticorps LOC100357368, anticorps padi2.S, anticorps Padi2

Sujet: PADI2 encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. PADI2 is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis.

Poids moléculaire: 75 kDa (MW of target protein)