PARD6A anticorps

N° du produit ABIN631173

Détail du produit anti-PARD6A anticorps

Antigène: PARD6A (Par-6 Partitioning Defective 6 Homolog alpha (PARD6A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARD6A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PARD6 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARD6A Blocking Peptide, catalog no. 33R-5734, is also available for use as a blocking control in assays to test for specificity of this PARD6A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARD6A

Antigène: PARD6A (Par-6 Partitioning Defective 6 Homolog alpha (PARD6A))

Autre désignation: PARD6A (PARD6A Produits)

Synonymes: anticorps PARD6A, anticorps 0710008C04Rik, anticorps 2610010A15Rik, anticorps PAR6alpha, anticorps Par-6, anticorps Par6, anticorps Par6c, anticorps TAX40, anticorps Tip-40, anticorps Par-6a, anticorps Par6a, anticorps PAR-6A, anticorps PAR6, anticorps PAR6C, anticorps TIP-40, anticorps par-6 partitioning defective 6 homolog alpha (C. elegans), anticorps par-6 family cell polarity regulator alpha, anticorps Partitioning defective protein 6, anticorps PARD6A, anticorps Pard6a, anticorps par-6

Sujet: This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization