ACTR2 anticorps
-
- Antigène Voir toutes ACTR2 Anticorps
- ACTR2 (Actin-Related Protein 2 (ACTR2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACTR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDK
- Top Product
- Discover our top product ACTR2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACTR2 Blocking Peptide, catalog no. 33R-7879, is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACTR2 (Actin-Related Protein 2 (ACTR2))
- Autre désignation
- ACTR2 (ACTR2 Produits)
- Synonymes
- anticorps ARP2, anticorps 4921510D23Rik, anticorps AA409782, anticorps Arp2, anticorps D6Ertd746e, anticorps actr2, anticorps hm:zeh1257, anticorps zgc:63719, anticorps actr2-B, anticorps arp2-B, anticorps arp2, anticorps ACTR2, anticorps DKFZp459N093, anticorps ACTIN RELATED PROTEIN 2, anticorps ATARP2, anticorps WRM, anticorps WURM, anticorps actin related protein 2, anticorps actr2-A, anticorps arp2-A, anticorps zgc:110550, anticorps ARP2 actin related protein 2 homolog, anticorps ARP2 actin-related protein 2, anticorps ARP2 actin related protein 2a homolog, anticorps ARP2 actin-related protein 2 homolog L homeolog, anticorps ARP2 actin-related protein 2 homolog, anticorps actin-related protein Arp2, anticorps actin related protein 2, anticorps ARP2 actin-related protein 2 homolog S homeolog, anticorps ARP2 actin related protein 2b homolog, anticorps ARP2/3 actin-organizing complex subunit Arp2, anticorps ACTR2, anticorps Actr2, anticorps actr2a, anticorps actr2.L, anticorps actr2, anticorps arp2, anticorps ARP2, anticorps actr2.S, anticorps actr2b
- Sujet
- ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. The specific function of this gene has not yet been determined.
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- Signalisation RTK, Regulation of Actin Filament Polymerization
-