SULT2B1 anticorps (Middle Region)
-
- Antigène Voir toutes SULT2B1 Anticorps
- SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SULT2B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SULT2 B1 antibody was raised against the middle region of SULT2 1
- Purification
- Affinity purified
- Immunogène
- SULT2 B1 antibody was raised using the middle region of SULT2 1 corresponding to a region with amino acids YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI
- Top Product
- Discover our top product SULT2B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SULT2B1 Blocking Peptide, catalog no. 33R-10242, is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))
- Autre désignation
- SULT2B1 (SULT2B1 Produits)
- Synonymes
- anticorps HSST2, anticorps AI326997, anticorps BB173635, anticorps ST2B1, anticorps SULT2B, anticorps SULT2B1, anticorps MGC79784, anticorps sulfotransferase family 2B member 1, anticorps sulfotransferase family, cytosolic, 2B, member 1, anticorps sulfotransferase family 2B member 1 L homeolog, anticorps SULT2B1, anticorps Sult2b1, anticorps sult2b1, anticorps sult2b1.L
- Sujet
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-