Peripherin anticorps (Middle Region)

N° du produit ABIN631186

Détail du produit anti-Peripherin anticorps

Antigène: Peripherin (PRPH)

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peripherin est non-conjugé

Application: Western Blotting (WB)

Specificité: PRPH antibody was raised against the middle region of PRPH

Purification: Affinity purified

Immunogène: PRPH antibody was raised using the middle region of PRPH corresponding to a region with amino acids YKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRPH Blocking Peptide, catalog no. 33R-10156, is also available for use as a blocking control in assays to test for specificity of this PRPH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Peripherin

Antigène: Peripherin (PRPH)

Autre désignation: PRPH (PRPH Produits)

Synonymes: anticorps NEF4, anticorps PRPH1, anticorps Prph1, anticorps Perf, anticorps nef4, anticorps prph1, anticorps MGC69454, anticorps if3, anticorps plasticin, anticorps zgc:111926, anticorps peripherin, anticorps peripherin L homeolog, anticorps PRPH, anticorps Prph, anticorps prph, anticorps prph.L

Sujet: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin.

Poids moléculaire: 54 kDa (MW of target protein)