NRBP2 anticorps (Middle Region)

N° du produit ABIN631188

Détail du produit anti-NRBP2 anticorps

Antigène: NRBP2

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NRBP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NRBP2 antibody was raised against the middle region of NRBP2

Purification: Affinity purified

Immunogène: NRBP2 antibody was raised using the middle region of NRBP2 corresponding to a region with amino acids VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NRBP2 Blocking Peptide, catalog no. 33R-9607, is also available for use as a blocking control in assays to test for specificity of this NRBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NRBP2

Antigène: NRBP2

Autre désignation: NRBP2 (NRBP2 Produits)

Synonymes: anticorps TRG16, anticorps pp9320, anticorps BC011468, anticorps nuclear receptor binding protein 2, anticorps Nrbp2, anticorps NRBP2

Sujet: The function of NRBP2 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 30 kDa (MW of target protein)