DSTYK anticorps (Middle Region)

N° du produit ABIN631202

Détail du produit anti-DSTYK anticorps

Antigène: DSTYK (Dual serine/threonine and tyrosine Protein Kinase (DSTYK))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DSTYK est non-conjugé

Application: Western Blotting (WB)

Specificité: RIPK5 antibody was raised against the middle region of RIPK5

Purification: Affinity purified

Immunogène: RIPK5 antibody was raised using the middle region of RIPK5 corresponding to a region with amino acids EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RIPK5 Blocking Peptide, catalog no. 33R-2341, is also available for use as a blocking control in assays to test for specificity of this RIPK5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIPK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DSTYK

Antigène: DSTYK (Dual serine/threonine and tyrosine Protein Kinase (DSTYK))

Autre désignation: RIPK5 (DSTYK Produits)

Synonymes: anticorps CAKUT1, anticorps DustyPK, anticorps RIP5, anticorps RIPK5, anticorps A930019K20Rik, anticorps C430014H23Rik, anticorps C820013G01, anticorps Ripk5, anticorps ripk5, anticorps zgc:136421, anticorps DSTYK, anticorps GB11994, anticorps DUSTYPK, anticorps dual serine/threonine and tyrosine protein kinase, anticorps receptor interacting protein kinase 5, anticorps dual serine/threonine and tyrosine protein kinase S homeolog, anticorps DSTYK, anticorps Dstyk, anticorps dstyk, anticorps Ripk5, anticorps dstyk.S

Sujet: RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.

Poids moléculaire: 100 kDa (MW of target protein)