NEDD4-2 anticorps (Middle Region)

N° du produit ABIN631206

Détail du produit anti-NEDD4-2 anticorps

Antigène: NEDD4-2 (NEDD4L) (E3 ubiquitin-protein ligase NEDD4-like (NEDD4L))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NEDD4-2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NEDD4 L antibody was raised against the middle region of NEDD4

Purification: Affinity purified

Immunogène: NEDD4 L antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NEDD4L Blocking Peptide, catalog no. 33R-9373, is also available for use as a blocking control in assays to test for specificity of this NEDD4L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NEDD4-2

Antigène: NEDD4-2 (NEDD4L) (E3 ubiquitin-protein ligase NEDD4-like (NEDD4L))

Autre désignation: NEDD4L (NEDD4L Produits)

Synonymes: anticorps NEDD4-2, anticorps NEDD4.2, anticorps RSP5, anticorps hNEDD4-2, anticorps nedd4, anticorps nedd4-2, anticorps NEDD4, anticorps Nedd4-2, anticorps 1300012C07Rik, anticorps Nedd4b, anticorps neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase, anticorps NEDD4L, anticorps neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase S homeolog, anticorps neural precursor cell expressed, developmentally down-regulated gene 4-like, anticorps NEDD4L, anticorps LOC776799, anticorps nedd4l.S, anticorps Nedd4l

Sujet: NEDD4L is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4L inhibits TGF-beta signaling by triggering SMAD2 and TGFR1 ubiquitination and proteasome-dependent degradation.

Poids moléculaire: 110 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity