MTIF3 anticorps (Middle Region)

N° du produit ABIN631213

Détail du produit anti-MTIF3 anticorps

Antigène: MTIF3 (Mitochondrial Translational Initiation Factor 3 (MTIF3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTIF3 est non-conjugé

Application: Western Blotting (WB)

Specificité: MTIF3 antibody was raised against the middle region of MTIF3

Purification: Affinity purified

Immunogène: MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTIF3 Blocking Peptide, catalog no. 33R-1612, is also available for use as a blocking control in assays to test for specificity of this MTIF3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTIF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTIF3

Antigène: MTIF3 (Mitochondrial Translational Initiation Factor 3 (MTIF3))

Autre désignation: MTIF3 (MTIF3 Produits)

Synonymes: anticorps 2810012L14Rik, anticorps AI414549, anticorps IF3mt, anticorps fd12b09, anticorps wu:fd12b09, anticorps si:ch211-271b14.5, anticorps MGC145669, anticorps MGC145704, anticorps mitochondrial translational initiation factor 3, anticorps mitochondrial translational initiation factor 3 L homeolog, anticorps Mtif3, anticorps MTIF3, anticorps mtif3, anticorps mtif3.L

Sujet: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization