APPL1 anticorps (Middle Region)
-
- Antigène Voir toutes APPL1 Anticorps
- APPL1 (Adaptor Protein, phosphotyrosine Interaction, PH Domain and Leucine Zipper Containing 1 (APPL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp APPL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- APPL1 antibody was raised against the middle region of APPL1
- Purification
- Affinity purified
- Immunogène
- APPL1 antibody was raised using the middle region of APPL1 corresponding to a region with amino acids GQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDD
- Top Product
- Discover our top product APPL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
APPL1 Blocking Peptide, catalog no. 33R-3487, is also available for use as a blocking control in assays to test for specificity of this APPL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APPL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- APPL1 (Adaptor Protein, phosphotyrosine Interaction, PH Domain and Leucine Zipper Containing 1 (APPL1))
- Autre désignation
- APPL1 (APPL1 Produits)
- Synonymes
- anticorps APPL, anticorps DIP13alpha, anticorps 2900057D21Rik, anticorps 7330406P05Rik, anticorps AI585782, anticorps AW209077, anticorps BB022931, anticorps C88264, anticorps DIP13, anticorps RGD1309388, anticorps adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1, anticorps adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1, anticorps APPL1, anticorps Appl1
- Sujet
- The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A.
- Poids moléculaire
- 80 kDa (MW of target protein)
-