UNC45A anticorps
-
- Antigène Voir toutes UNC45A Anticorps
- UNC45A (Unc-45 Homolog A (UNC45A))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UNC45A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- UNC45 A antibody was raised using a synthetic peptide corresponding to a region with amino acids REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
- Top Product
- Discover our top product UNC45A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UNC45A Blocking Peptide, catalog no. 33R-7872, is also available for use as a blocking control in assays to test for specificity of this UNC45A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC40 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UNC45A (Unc-45 Homolog A (UNC45A))
- Autre désignation
- UNC45A (UNC45A Produits)
- Synonymes
- anticorps smap1, anticorps smap-1, anticorps gcunc45, anticorps MGC89261, anticorps gc-unc45, anticorps gcunc-45, anticorps iro039700, anticorps zgc:112031, anticorps GC-UNC45, anticorps GCUNC-45, anticorps GCUNC45, anticorps IRO039700, anticorps SMAP-1, anticorps SMAP1, anticorps AW538196, anticorps RGD1305357, anticorps unc-45 myosin chaperone A, anticorps UNC45A, anticorps unc45a, anticorps Unc45a
- Sujet
- UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor and HSP90, and acts as a regulator of the progesterone receptor chaperoning pathway.
- Poids moléculaire
- 102 kDa (MW of target protein)
-