PRKRIR anticorps
-
- Antigène Voir toutes PRKRIR Anticorps
- PRKRIR (Protein-Kinase, Interferon-Inducible Double Stranded RNA Dependent Inhibitor, Repressor of (p58 Repressor) (PRKRIR))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRKRIR est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PRKRIR antibody was raised using a synthetic peptide corresponding to a region with amino acids VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT
- Top Product
- Discover our top product PRKRIR Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRKRIR Blocking Peptide, catalog no. 33R-9506, is also available for use as a blocking control in assays to test for specificity of this PRKRIR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRIR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRKRIR (Protein-Kinase, Interferon-Inducible Double Stranded RNA Dependent Inhibitor, Repressor of (p58 Repressor) (PRKRIR))
- Autre désignation
- PRKRIR (PRKRIR Produits)
- Synonymes
- anticorps DAP4, anticorps P52rIPK, anticorps THAP0, anticorps THAP12, anticorps 2900052B10Rik, anticorps Dap4, anticorps Rpkrir, anticorps dap4, anticorps p52ripk, anticorps MGC75860, anticorps PRKRIR, anticorps prkrir, anticorps prkrir.S, anticorps THAP domain containing 12, anticorps THAP domain containing 12 S homeolog, anticorps THAP12, anticorps Thap12, anticorps thap12, anticorps thap12.S
- Sujet
- PRKRIR is upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). PRKRIR may block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth.
- Poids moléculaire
- 88 kDa (MW of target protein)
-