PIP4K2A anticorps (N-Term)
-
- Antigène Voir toutes PIP4K2A Anticorps
- PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, alpha (PIP4K2A))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIP4K2A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PIP4 K4 antibody was raised against the N terminal of PIP4 4
- Purification
- Affinity purified
- Immunogène
- PIP4 K4 antibody was raised using the N terminal of PIP4 4 corresponding to a region with amino acids IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH
- Top Product
- Discover our top product PIP4K2A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIP4K2A Blocking Peptide, catalog no. 33R-3909, is also available for use as a blocking control in assays to test for specificity of this PIP4K2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, alpha (PIP4K2A))
- Autre désignation
- PIP4K2A (PIP4K2A Produits)
- Synonymes
- anticorps PI5P4KA, anticorps PIP5K2A, anticorps PIP5KII-alpha, anticorps PIP5KIIA, anticorps PIPK, anticorps AW742916, anticorps Pip5k2a, anticorps pipk, anticorps pi5p4ka, anticorps pip5k2a, anticorps pip5kiia, anticorps pip4k2a, anticorps zgc:194746, anticorps zgc:194777, anticorps phosphatidylinositol-5-phosphate 4-kinase type 2 alpha, anticorps phosphatidylinositol-5-phosphate 4-kinase, type II, alpha, anticorps phosphatidylinositol-5-phosphate 4-kinase, type II, alpha S homeolog, anticorps phosphatidylinositol-5-phosphate 4-kinase, type II, alpha a, anticorps PIP4K2A, anticorps Pip4k2a, anticorps pip4k2a.S, anticorps pip4k2a, anticorps pip4k2aa
- Sujet
- Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility.
- Poids moléculaire
- 46 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-