PRKRIP1 anticorps

N° du produit ABIN631288

Détail du produit anti-PRKRIP1 anticorps

Antigène: PRKRIP1 (Prkr Interacting Protein 1 (IL11 Inducible) (PRKRIP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKRIP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PRKRIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKRIP1 Blocking Peptide, catalog no. 33R-5756, is also available for use as a blocking control in assays to test for specificity of this PRKRIP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRKRIP1

Antigène: PRKRIP1 (Prkr Interacting Protein 1 (IL11 Inducible) (PRKRIP1))

Autre désignation: PRKRIP1 (PRKRIP1 Produits)

Synonymes: anticorps C114, anticorps KRBOX3, anticorps 8430424D23Rik, anticorps PRKR interacting protein 1, anticorps Prkr interacting protein 1 (IL11 inducible), anticorps PRKR interacting protein 1 (IL11 inducible), anticorps PRKR interacting protein 1) L homeolog, anticorps PRKRIP1, anticorps Prkrip1, anticorps prkrip1, anticorps prkrip1.L

Sujet: PRKRIP1 binds double-stranded RNA. It inhibits EIF2AK2 kinase activity.

Poids moléculaire: 21 kDa (MW of target protein)