MYLIP anticorps (Middle Region)
-
- Antigène Voir toutes MYLIP Anticorps
- MYLIP (Myosin Regulatory Light Chain Interacting Protein (MYLIP))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MYLIP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MYLIP antibody was raised against the middle region of MYLIP
- Purification
- Affinity purified
- Immunogène
- MYLIP antibody was raised using the middle region of MYLIP corresponding to a region with amino acids CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE
- Top Product
- Discover our top product MYLIP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MYLIP Blocking Peptide, catalog no. 33R-1817, is also available for use as a blocking control in assays to test for specificity of this MYLIP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYLIP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MYLIP (Myosin Regulatory Light Chain Interacting Protein (MYLIP))
- Autre désignation
- MYLIP (MYLIP Produits)
- Synonymes
- anticorps IDOL, anticorps MIR, anticorps 9430057C20Rik, anticorps Mir, anticorps mylip, anticorps wu:fj36b03, anticorps zgc:55987, anticorps MYLIP, anticorps mir, anticorps zgc:153767, anticorps myosin regulatory light chain interacting protein, anticorps myosin regulatory light chain interacting protein a, anticorps myosin regulatory light chain interacting protein L homeolog, anticorps myosin regulatory light chain interacting protein b, anticorps MYLIP, anticorps Mylip, anticorps mylipa, anticorps mylip.L, anticorps mylip, anticorps mylipb
- Sujet
- The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.
- Poids moléculaire
- 50 kDa (MW of target protein)
-