NUDT13 anticorps
-
- Antigène Voir toutes NUDT13 Anticorps
- NUDT13 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NUDT13 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NUDT13 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY
- Top Product
- Discover our top product NUDT13 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NUDT13 Blocking Peptide, catalog no. 33R-6470, is also available for use as a blocking control in assays to test for specificity of this NUDT13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NUDT13 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13))
- Autre désignation
- NUDT13 (NUDT13 Produits)
- Sujet
- NUDT13 contains 1 nudix hydrolase domain. The exact function of NUDT13 remains unknown.
- Poids moléculaire
- 40 kDa (MW of target protein)
-