RFFL anticorps (Middle Region)

N° du produit ABIN631340

Détail du produit anti-RFFL anticorps

Antigène: RFFL (Ring Finger and FYVE-Like Domain Containing 1 (RFFL))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RFFL est non-conjugé

Application: Western Blotting (WB)

Specificité: RFFL antibody was raised against the middle region of RFFL

Purification: Affinity purified

Immunogène: RFFL antibody was raised using the middle region of RFFL corresponding to a region with amino acids KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RFFL Blocking Peptide, catalog no. 33R-4301, is also available for use as a blocking control in assays to test for specificity of this RFFL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFFL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RFFL

Antigène: RFFL (Ring Finger and FYVE-Like Domain Containing 1 (RFFL))

Autre désignation: RFFL (RFFL Produits)

Synonymes: anticorps MGC84042, anticorps RFFL, anticorps Rffl, anticorps 1700051E09Rik, anticorps 4930516L10Rik, anticorps BG080975, anticorps Carp2, anticorps CARP-2, anticorps CARP2, anticorps FRING, anticorps RIFIFYLIN, anticorps RNF189, anticorps RNF34L, anticorps ring finger and FYVE like domain containing E3 ubiquitin protein ligase, anticorps ring finger and FYVE-like domain containing E3 ubiquitin protein ligase L homeolog, anticorps ring finger and FYVE-like domain containing 1, anticorps ring finger and FYVE like domain containing protein, anticorps ring finger and FYVE-like domain containing E3 ubiquitin protein ligase, anticorps RFFL, anticorps rffl.L, anticorps Rffl

Sujet: RFFL has E3 ubiquitin protein ligase activity.RFFL regulates the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. RFFL may bind phosphatidylinositol phosphates.

Poids moléculaire: 40 kDa (MW of target protein)