HACE1 anticorps (Middle Region)

N° du produit ABIN631377

Détail du produit anti-HACE1 anticorps

Antigène: HACE1 (HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HACE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HACE1 antibody was raised against the middle region of HACE1

Purification: Affinity purified

Immunogène: HACE1 antibody was raised using the middle region of HACE1 corresponding to a region with amino acids DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HACE1 Blocking Peptide, catalog no. 33R-2223, is also available for use as a blocking control in assays to test for specificity of this HACE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HACE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HACE1

Antigène: HACE1 (HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1))

Autre désignation: HACE1 (HACE1 Produits)

Synonymes: anticorps HACE1, anticorps 1700042J16Rik, anticorps A730034A22Rik, anticorps BC025474, anticorps HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1, anticorps HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 L homeolog, anticorps HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1, anticorps HACE1, anticorps hace1, anticorps hace1.L, anticorps Hace1

Sujet: HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.

Poids moléculaire: 102 kDa (MW of target protein)