HERC4 anticorps (Middle Region)

N° du produit ABIN631378

Détail du produit anti-HERC4 anticorps

Antigène: HERC4 (Hect Domain and RLD 4 (HERC4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HERC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: HERC4 antibody was raised against the middle region of HERC4

Purification: Affinity purified

Immunogène: HERC4 antibody was raised using the middle region of HERC4 corresponding to a region with amino acids LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HERC4 Blocking Peptide, catalog no. 33R-5516, is also available for use as a blocking control in assays to test for specificity of this HERC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HERC4

Antigène: HERC4 (Hect Domain and RLD 4 (HERC4))

Autre désignation: HERC4 (HERC4 Produits)

Sujet: HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD).

Poids moléculaire: 118 kDa (MW of target protein)