RNF212 anticorps (Middle Region)
-
- Antigène Voir toutes RNF212 Anticorps
- RNF212 (Ring Finger Protein 212 (RNF212))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF212 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RNF212 antibody was raised against the middle region of RNF212
- Purification
- Affinity purified
- Immunogène
- RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS
- Top Product
- Discover our top product RNF212 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF212 Blocking Peptide, catalog no. 33R-4823, is also available for use as a blocking control in assays to test for specificity of this RNF212 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF212 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF212 (Ring Finger Protein 212 (RNF212))
- Autre désignation
- RNF212 (RNF212 Produits)
- Synonymes
- anticorps ZHP3, anticorps ring finger protein 212, anticorps RNF212
- Sujet
- RNF212 contains 1 RING-type zinc finger. The function of the RNF212 protein remains unknown.
- Poids moléculaire
- 26 kDa (MW of target protein)
-