RNF169 anticorps (N-Term)

N° du produit ABIN631397

L’anticorps Lapin Polyclonal anti-RNF169 a été validé pour WB. Il convient pour détecter RNF169 dans des échantillons de Humain et Rat.

Aperçu rapide pour RNF169 anticorps (N-Term) (ABIN631397)

Antigène: RNF169 (Ring Finger Protein 169 (RNF169))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF169 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RNF169 anticorps

Épitope: N-Term

Specificité: RNF169 antibody was raised against the N terminal of RNF169

Purification: Affinity purified

Immunogène: RNF169 antibody was raised using the N terminal of RNF169 corresponding to a region with amino acids DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF169 Blocking Peptide, (ABIN937578), is also available for use as a blocking control in assays to test for specificity of this RNF169 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF169 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF169

Antigène: RNF169 (Ring Finger Protein 169 (RNF169))

Autre désignation: RNF169

Sujet: The function of RNF169 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 77 kDa (MW of target protein)