CRYBB3 anticorps (Middle Region)
-
- Antigène Voir toutes CRYBB3 (CRYbB3) Anticorps
- CRYBB3 (CRYbB3) (Crystallin, beta B3 (CRYbB3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRYBB3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Crystallin Beta B3 antibody was raised against the middle region of CRYBB3
- Purification
- Affinity purified
- Immunogène
- Crystallin Beta B3 antibody was raised using the middle region of CRYBB3 corresponding to a region with amino acids LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING
- Top Product
- Discover our top product CRYbB3 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Crystallin Beta B3 Blocking Peptide, catalog no. 33R-5223, is also available for use as a blocking control in assays to test for specificity of this Crystallin Beta B3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYBB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRYBB3 (CRYbB3) (Crystallin, beta B3 (CRYbB3))
- Autre désignation
- Crystallin beta B3 (CRYbB3 Produits)
- Synonymes
- anticorps MGC84109, anticorps CATCN2, anticorps CRYB3, anticorps CTRCT22, anticorps AI852419, anticorps crystallin beta B3 L homeolog, anticorps crystallin beta B3, anticorps crystallin, beta B3, anticorps crybb3.L, anticorps CRYBB3, anticorps crybb3, anticorps Crybb3
- Sujet
- Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens.
- Poids moléculaire
- 24 kDa (MW of target protein)
-